Resource Type

Technology

webinar

Five Early Challenges Of Building Streaming & Fast Data Applications

fast-dataakka

technical-overview

Lightbend Fast Data Platform (FDP) - A Technical Overview For Decision Makers

fast-dataakkaplaylagom

white-paper

The Secrets To Successfully Monitoring Fast Data And Streaming Applications

fast-dataenterprise-suite

webinar

How Credit Karma Makes Real-Time Decisions for 60 Million Users with Akka Streams and Apache Kafka

fast-dataakka

case-study

Flipkart Reduces Infrastructure By 75% And "Connekts" With 70 Million Shoppers Using Reactive Microservices

legacy-modernizationcustomer-engagementmicroservices

case-study

Weight Watchers Accelerates Digital Transformation With Lightbend

microservicesfast-dataakkaplayscala

video

Replacing Cron & Building Scalable Data Pipelines At Airbnb

legacy-modernizationscala

white-paper

Microservices in Production: What Ops Should Know About Reactive Systems

microservicesenterprise-suite

report

Enterprise Development Trends 2016

microservices

ebook

Learn Scala for Java Developers

scalajava

webinar

Building Streaming and Fast Data Applications with Spark, Mesos, Akka, Cassandra and Kafka

fast-dataakka

webinar

Developing Fast Data Architectures with Streaming Applications

fast-dataakka

webinar

Using the Actor Model with Domain-Driven Design (DDD) in Reactive Systems

microservicesakka

ebook

Stream Processing with Apache Flink Scala

fast-data

podcast

Interview: CEO Mark Brewer On Lightbend's Acquisition Of OpsClarity

podcast

Reflections With Adriaan Moors On 10 Years With Scala

scala

webinar

Exploring Reactive Integrations with Akka Streams, Alpakka and Kafka

microservicesfast-dataakkalagomscalajava

case-study

Credit Karma Disrupts Credit Reporting With Reactive Systems And Fast Data

legacy-modernizationcustomer-engagementfast-data

podcast

Reactive Programming vs Reactive Systems, Explained

white-paper

Getting Started with Spark

fast-data

white-paper

Reactive Programming vs Reactive Systems

webinar

The Basics Of Reactive System Design For Traditional Java Enterprises

microservicesakkalagomjavalegacy-modernization

webinar

Distributed Systems Done Right: Why Java Enterprises Are Embracing The Actor Model

microservicesakkascalajava

case-study

PayPal Blows Past 1 Billion Transactions Per Day Using Just 8 VMs With Akka, Scala, Kafka and Akka Streams

legacy-modernizationcustomer-engagementmicroservicesakkascala

webinar

Lessons Learned From PayPal: Implementing Back-Pressure With Akka Streams And Kafka

microservicesfast-dataakkascalalegacy-modernization

webinar

Fast Data: Selecting The Right Streaming Technologies For Data Sets That Never End

microservicesfast-dataakkascalajava

webinar

Introducing Reactive Platform 2.0

microservicesakkaplaylagomscalajava

case-study

Swisscom Revolutionizes Urban Planning Data With Real-Time Mobile Analytics

new-businessmicroservicesfast-dataakkascala

technical-overview

Lightbend Reactive Platform

akkaplaylagomscalajava

report

Going Reactive 2016: How Microservices and Fast Data are driving mainstream adoption of Reactive systems

microservicesfast-data

webinar

Overcoming Tough Architecture Challenges In Your Next Modernization Project

legacy-modernizationmicroservicesfast-dataenterprise-suite

case-study

Zalando Reaches Past $3 Billion In Sales Amid 100x Traffic Spikes Using Reactive Platform

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

ebook

Designing Reactive Systems: The Role Of Actors In Distributed Architecture

ebook

Fast Data Architectures For Streaming Applications

fast-data

webinar

Monitoring Microservices in Production with Lightbend Platform

microservicesfast-dataenterprise-suiteakkaplaylagomscalajava

case-study

Distributed Mesh In The Home: How Eero Is Disrupting Consumer WiFi With Highly Reliable Systems Powered By Akka And Reactive

internet-of-thingsakkascala

webinar

Modernizing Applications with Microservices and DCOS

microservicesscala

webinar

Lessons Learned From Verizon: Implementing Microservices

microservicesscalaplaynew-business

webinar

The Future of Services: Building Asynchronous, Resilient and Elastic Systems

microservices

webinar

Understanding Akka Streams, Back Pressure and Asynchronous Architectures

microservicesfast-datascalaakkajavainternet-of-things

webinar

The Enterprise Architect’s Intro to Microservices - Part 3: Bending Reality with Microservices in Production Systems

microserviceslegacy-modernization

webinar

The Enterprise Architect’s Intro to Microservices - Part 2: The 6 Traits of Reactive Microservices

microserviceslegacy-modernization

podcast

AMA with Our Experts Podcast Ep. 09 with Andreas Evers

microserviceslagom

case-study

Curing Cancer At Driver Group With Scala, Slick, Play And Apache Spark

new-businessplayscala

webinar

The Enterprise Architect’s Intro to Microservices - Part 1: Microservices, Monoliths, SOA and How We Got Here

microserviceslegacy-modernization

ebook

Developing Reactive Microservices

microservices

ebook

Reactive Machine Learning Systems

podcast

AMA with Our Experts Podcast Ep. 08 with Jamie Allen

podcast

AMA with Our Experts Podcast Ep. 07 with Markus Eisele

microserviceslagomjava

case-study

The Software Strategy Behind Verizon's $40 Billion Mobile Content Opportunity

new-businessmicroservicesplayscala

case-study

Norwegian Cruises To Record Profits With Reactive

legacy-modernizationinternet-of-thingscustomer-engagementakkaplayscala

ebook

Reactive Microservices Architecture

microservices

podcast

AMA with Our Experts Podcast Ep. 06 with Justin Pihony

podcast

AMA with Our Experts Podcast Ep. 05 with Viktor Klang

microservices

podcast

AMA with Our Experts Podcast Ep. 04 with Oliver White

podcast

AMA with Our Experts Podcast Ep. 03 with Jonas Bonér

microservices

podcast

Lightbend Reactive Platform: new commercial features - Jamie Allen

akka

podcast

Akka 2.4 plus new commercial features in Lightbend Reactive Platform - Konrad Malawski

akka

podcast

AMA with Our Experts Podcast Ep. 02 with Konrad Malawski

podcast

AMA with Our Experts Podcast Ep. 01 with Dean Wampler

fast-data

podcast

Welcome To Reactive Monitoring Beta Program - Henrik Engström and Tal Weiss

enterprise-suite

case-study

Intel's GearPump Real-Time Streaming Engine Using Akka

new-businessmicroservicesfast-dataakkascala

case-study

Reactive Drives Innovation In Streaming Music Industry

legacy-modernizationcustomer-engagementmicroservicesakka

case-study

Samsung Strategy And Innovation Center Executes IoT Vision At Startup-Speed With Reactive Architecture

internet-of-thingsnew-businessmicroservicesfast-dataakkaplayscala

podcast

How To Deploy Spark To Mesos, EC2 Or Standalone With Lightbend - Iulian Dragos

fast-data

podcast

Reactive For DevOps: Using ConductR To Maintain System Resiliency

case-study

How Apache Spark, Scala, And Functional Programming Made Hard Problems Easy At Barclays

fast-datascala

podcast

Reactive Revealed 3 3 Resiliency, Failures Vs Errors, Isolation, Delegation - Jonas Bonér

podcast

Using ConductR With Docker On The JVM - Ed Callahan

enterprise-suite

webinar

Akka 2.4 Plus New Commercial Features in Lightbend Reactive Platform

microservicesakkascalajava

webinar

Using ConductR with Docker on the JVM

production-suite

white-paper

An Introduction to Reactive Streams, Akka Streams and Akka HTTP for Enterprise Architects

akka

podcast

Elasticity, Scalability And Location Transparency In Reactive Systems - Viktor Klang

webinar

Reactive Revealed 2/3: Elasticity, Scalability and Location Transparency in Reactive systems

microservices

case-study

How Dwango Scaled Live Streaming With Play And Akka

legacy-modernizationakkaplayscala

white-paper

Fast Data: Big Data Evolved

fast-data

case-study

UniCredit Powers “Fast Data” Customer-Insight Platform With Apache Spark, Scala, Akka And Play

legacy-modernizationcustomer-engagementmicroservicesfast-dataakkaplayscala

case-study

UK’s Online Gaming Leader Bets Big On Reactive To Drive Real-Time Personalization

customer-engagementmicroservicesfast-dataakkaplayscala

webinar

Reactive Architectures Using Microservices (or Not)

microservices

podcast

Asynchronous I O, Back - Pressure And The Message - Driven Vs. Event - Driven - Konrad Malawski

webinar

Reactive Revealed 1/3: Async NIO, Back-pressure and Message-driven vs Event-driven

akka

webinar

​Microservices 101: Exploiting Reality's Constraints with Technology

microservicesscalajava

webinar

Using ConductR to manage and deploy Reactive applications to the [hybrid] cloud

microservicesenterprise-suite

podcast

Four Things To Know About Reliable Spark Streaming - Tathagata Das and Dean Wampler

fast-data

webinar

Four things to know about reliable Spark Streaming

fast-datascala

webinar

Akka Streams 1.0 and Slick 3.0

akka

webinar

Modernizing Your Aging Architecture: What Every Enterprise Architect Needs To Know About Going Reactive

microservicesfast-datalegacy-modernization

podcast

Using Spark, Kafka, Cassandra And Akka On Mesos For Real Time Personalization - Patrick Di Loreto

fast-data

case-study

Dutch E-Commerce Giant Wehkamp Drives Global Expansion By Modernizing Systems For “Reactive”

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

webinar

Using Spark, Kafka, Cassandra and Akka on Mesos for Real-Time Personalization

microservicesfast-dataakkaplayscalacustomer-engagement

webinar

Reactive Streams 1.0.0 and Why You Should Care

akkascala

ebook

Functional and Reactive Domain Modeling

case-study

UK Price Comparison Leader Goes "Reactive" To Fuel Next Phase Of Growth

legacy-modernizationmarket-expansionmicroservicesakkaplay

case-study

New Tweets Per Second Record, And How!

legacy-modernizationcustomer-engagementscala

ebook

Spark in Action

fast-data

case-study

47 Degrees adopts the Lightbend Platform

legacy-modernizationnew-businessmicroservicesakkaplayscala

case-study

A British Consultancy Chooses Lightbend

legacy-modernizationnew-businessmicroservicesfast-dataakkaplayscala

case-study

Keeping Borders Safe With Akka

legacy-modernizationinternet-of-thingsakkascala

case-study

Lightbend Aids In Train Safety In The Netherlands

scalaakka

podcast

Going Reactive In Java With Lightbend Reactive Platform - Jamie Allen

case-study

From 5 To 50 Million Users And Beyond: Why Wix Went Reactive

legacy-modernizationscala

case-study

2.2 Billion Clicks And Beyond: How Hootsuite Modernized Its URL Shortener To Scala/Akka Using The Lightbend Reactive Platform

legacy-modernizationmicroservicesakkascala

case-study

The Play Framework At LinkedIn

legacy-modernizationcustomer-engagementplay

case-study

Walmart Boosts Conversions By 20% With Lightbend Reactive Platform

legacy-modernizationcustomer-engagementmicroservicesakkaplayscala

webinar

Akka for Java Devs: Bridging the Imagination Divide

akkascalajava

ebook

Reactive Web Applications

webinar

Trends and Adoption: What's Hot in Apache Spark

fast-datascalaakka

ebook

Reactive Application Development

report

Apache Spark: Preparing for the Next Wave of Reactive Big Data

fast-data

report

Java 8 Report II: A Global Survey of 3,030 Java Professionals

java

ebook

Play Framework Essentials

play

ebook

SBT in Action

scala

ebook

Akka in Action

akka

ebook

Atomic Scala

scala

ebook

Functional Programming in Scala

scala

ebook

Java 8 in Action

java

ebook

Play for Java

playjava

ebook

Play for Scala

playscala

ebook

Reactive Design Patterns

ebook

Scala for the Impatient

scala

ebook

Scala in Depth

scala

ebook

Spark GraphX in Action

fast-data

report

Java 8 Report I

java

white-paper

Why the Media Industry is Going Reactive