Learn

Videos and Webinars

Technology

video

How to use CQRS in Akka 2.6 video

akka

akka

video

Managing Blocking in Akka video

akka

akka

webinar

Lessons From HPE: From Batch To Streaming For 20 Billion Sensors With Lightbend Platform

microservices

microservices

video

Event Sourcing with Akka 2.6 video

akka

akka

video

Introduction to Akka Cluster Sharding video

akka

akka

webinar

How to build streaming data pipelines with Akka Streams, Flink, and Spark using Cloudflow

microservices

microservices

video

Akka 2.6 Actor introduction video

akka

akka

webinar

Full Stack Reactive In Practice

microserviceslagom

microserviceslagom

webinar

Microservices, Kubernetes, and Application Modernization Done Right

legacy-modernizationmicroservices

legacy-modernizationmicroservices

webinar

Migrating From Java EE To Cloud-Native Reactive Systems

java

java

webinar

Running Kafka On Kubernetes With Strimzi For Real-Time Streaming Applications

webinar

Designing Events-First Microservices For A Cloud Native World

microservicesfast-data

microservicesfast-data

webinar

Scala Security: Eliminate 200+ Code-Level Threats With Fortify SCA For Scala

fast-data

fast-data

webinar

How To Build, Integrate, and Deploy Real-Time Streaming Pipelines On Kubernetes

fast-data

fast-data

webinar

Akka and Kubernetes: Reactive From Code To Cloud

akka

akka

webinar

How Akka Works: Visualize And Demo Akka With A Raspberry-Pi Cluster

akka

akka

webinar

Executive Briefing: What Is Fast Data And Why Is It Important?

fast-data

fast-data

webinar

Putting Kafka In Jail - Best Practices To Run Kafka On Kubernetes & DC/OS

akka

akka

webinar

Akka, Spark or Kafka? Selecting The Right Streaming Engine For the Job

microservicesfast-dataakka

microservicesfast-dataakka

webinar

Concept Drift: Monitoring Model Quality in Streaming ML Applications

fast-data

fast-data

webinar

Revitalizing Enterprise Integration with Reactive Streams

microservicesfast-data

microservicesfast-data

webinar

Streaming Microservices with Akka Streams and Kafka Streams

microservicesfast-data

microservicesfast-data

webinar

Microservices and Fast Data: Industry and Architecture Trends

fast-data

fast-data

webinar

Operationalizing Machine Learning - Serving ML Models

fast-data

fast-data

video

One Digital: Verizon Wireless Reactive Commerce Transformation Journey

akkaplay

akkaplay

video

Lightbend Fast Data Platform Demonstration

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Designing Fast Data Applications - Resilient, Scalable Architectures And Deployment Strategies

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Building Fast Data Applications - Developer Tools For Performance Tuning And Deployment

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Running Fast Data Applications - Intelligent Monitoring And Troubleshooting

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Running Fast Data Applications - Resilient Production Tools And One-Stop Support

fast-data

fast-data

video

Building Fast Data Applications - Development Team Enablement And Productivity

fast-data

fast-data

video

Designing Fast Data Applications - How To Choose The Right Streaming Engine

fast-data

fast-data

video

Understanding Fast Data Applications - The Why, What, And How

fast-data

fast-data

webinar

Advanced Akka For Architects

akka

akka

webinar

A Tale of Two APIs: Using Spark Streaming In Production

fast-data

fast-data

webinar

Developing Secure Scala Applications With Fortify For Scala

scala

scala

webinar

Intelligently Monitor and Rapidly Troubleshoot Streaming Fast Data Applications

legacy-modernizationmicroservicesfast-dataakka

legacy-modernizationmicroservicesfast-dataakka

webinar

Design Streaming Fast Data Applications With Spark, Akka, Kafka and Cassandra on Mesos

fast-dataakka

fast-dataakka

video

How Can Lightbend Help? - Episode 3

fast-data

fast-data

video

What's Hard About Fast Data? - Episode 2

fast-data

fast-data

video

Fast Data: How Did We Get Here? - Episode 1

fast-data

fast-data

webinar

Akka Revealed: A JVM Architect’s Journey From Resilient Actors To Scalable Clusters

akka

akka

video

Introducing "Lightbend Reactive Architecture - Professional” Remote/Onsite Training Course

legacy-modernizationmicroservices

legacy-modernizationmicroservices

webinar

Why IBM + Lightbend

scalajava

scalajava

video

I Love Scala for Machine Learning

fast-datascala

fast-datascala

webinar

What's The Role of Machine Learning In Fast Data and Streaming Applications?

fast-data

fast-data

webinar

Moving from Big Data to Fast Data? Here's How To Pick The Right Streaming Engine

fast-data

fast-data

webinar

Five Early Challenges Of Building Streaming & Fast Data Applications

fast-dataakka

fast-dataakka

webinar

How Credit Karma Makes Real-Time Decisions for 60 Million Users with Akka Streams and Apache Kafka

fast-dataakka

fast-dataakka

video

Replacing Cron & Building Scalable Data Pipelines At Airbnb

legacy-modernizationscala

legacy-modernizationscala

webinar

Building Streaming and Fast Data Applications with Spark, Mesos, Akka, Cassandra and Kafka

fast-dataakka

fast-dataakka

webinar

Developing Fast Data Architectures with Streaming Applications

fast-dataakka

fast-dataakka

webinar

Using the Actor Model with Domain-Driven Design (DDD) in Reactive Systems

microservicesakka

microservicesakka

webinar

Exploring Reactive Integrations with Akka Streams, Alpakka and Kafka

microservicesfast-dataakkalagomscalajava

microservicesfast-dataakkalagomscalajava

webinar

The Basics Of Reactive System Design For Traditional Java Enterprises

microservicesakkalagomjavalegacy-modernization

microservicesakkalagomjavalegacy-modernization

webinar

Distributed Systems Done Right: Why Java Enterprises Are Embracing The Actor Model

microservicesakkascalajava

microservicesakkascalajava

webinar

Lessons Learned From PayPal: Implementing Back-Pressure With Akka Streams And Kafka

microservicesfast-dataakkascalalegacy-modernization

microservicesfast-dataakkascalalegacy-modernization

webinar

Fast Data: Selecting The Right Streaming Technologies For Data Sets That Never End

microservicesfast-dataakkascalajava

microservicesfast-dataakkascalajava

webinar

Introducing Reactive Platform 2.0

microservicesakkaplaylagomscalajava

microservicesakkaplaylagomscalajava

webinar

Overcoming Tough Architecture Challenges In Your Next Modernization Project

legacy-modernizationmicroservicesfast-data

legacy-modernizationmicroservicesfast-data

webinar

Monitoring Microservices in Production with Lightbend Platform

microservicesfast-dataakkaplaylagomscalajava

microservicesfast-dataakkaplaylagomscalajava

webinar

Modernizing Applications with Microservices and DCOS

microservicesscala

microservicesscala

webinar

Lessons Learned From Verizon: Implementing Microservices

microservicesscalaplaynew-business

microservicesscalaplaynew-business

webinar

The Future of Services: Building Asynchronous, Resilient and Elastic Systems

microservices

microservices

webinar

Understanding Akka Streams, Back Pressure and Asynchronous Architectures

microservicesfast-datascalaakkajavainternet-of-things

microservicesfast-datascalaakkajavainternet-of-things

webinar

The Enterprise Architect’s Intro to Microservices - Part 3: Bending Reality with Microservices in Production Systems

microserviceslegacy-modernization

microserviceslegacy-modernization

webinar

The Enterprise Architect’s Intro to Microservices - Part 2: The 6 Traits of Reactive Microservices

microserviceslegacy-modernization

microserviceslegacy-modernization

webinar

The Enterprise Architect’s Intro to Microservices - Part 1: Microservices, Monoliths, SOA and How We Got Here

microserviceslegacy-modernization

microserviceslegacy-modernization

webinar

Akka 2.4 Plus New Commercial Features in Lightbend Reactive Platform

microservicesakkascalajava

microservicesakkascalajava

webinar

Reactive Revealed 2/3: Elasticity, Scalability and Location Transparency in Reactive systems

microservices

microservices

webinar

Reactive Revealed 1/3: Async NIO, Back-pressure and Message-driven vs Event-driven

akka

akka

webinar

​Microservices 101: Exploiting Reality's Constraints with Technology

microservicesscalajava

microservicesscalajava

webinar

Four things to know about reliable Spark Streaming

fast-datascala

fast-datascala

webinar

Akka Streams 1.0 and Slick 3.0

akka

akka

webinar

Modernizing Your Aging Architecture: What Every Enterprise Architect Needs To Know About Going Reactive

microservicesfast-datalegacy-modernization

microservicesfast-datalegacy-modernization

webinar

Using Spark, Kafka, Cassandra and Akka on Mesos for Real-Time Personalization

microservicesfast-dataakkaplayscalacustomer-engagement

microservicesfast-dataakkaplayscalacustomer-engagement

webinar

Reactive Streams 1.0.0 and Why You Should Care

akkascala

akkascala

webinar

Akka for Java Devs: Bridging the Imagination Divide

akkascalajava

akkascalajava

webinar

Trends and Adoption: What's Hot in Apache Spark

fast-datascalaakka

fast-datascalaakka

Questions?