Resource Type

Technology

case-study

How HPE is transforming the customer experience with near real-time insights

internet-of-thingscustomer-engagementmicroservicesfast-data

internet-of-thingscustomer-engagementmicroservicesfast-data

webinar

Putting Kafka In Jail - Best Practices To Run Kafka On Kubernetes & DC/OS

akka

akka

code

Quick start reactive app development using a starter kit in IBM Cloud

lagom

lagom

code

Deploying a Lagom app to IBM Cloud Private

lagom

lagom

code

Deploying a Lagom app using IBM Cloud Container Service

lagom

lagom

webinar

Akka, Spark or Kafka? Selecting The Right Streaming Engine For the Job

microservicesfast-dataakka

microservicesfast-dataakka

white-paper

Akka A to Z: The Architect's Guide To Designing, Building, And Running Reactive Systems

akka

akka

training

Scala 101

scala

scala

webinar

Concept Drift: Monitoring Model Quality in Streaming ML Applications

fast-data

fast-data

ebook

Understand And Design Fast Data & Streaming Applications

customer-engagementmicroservicesfast-data

customer-engagementmicroservicesfast-data

ebook

Build And Deploy Fast Data And Streaming Applications

customer-engagementmicroservicesfast-data

customer-engagementmicroservicesfast-data

webinar

Revitalizing Enterprise Integration with Reactive Streams

microservicesfast-dataenterprise-suite

microservicesfast-dataenterprise-suite

case-study

How MiddleGate is Using Akka to Disrupt the $471 Billion Medical Billing Industry

akka

akka

ebook

Scala Microservices

legacy-modernizationcustomer-engagementmicroservicesfast-data

legacy-modernizationcustomer-engagementmicroservicesfast-data

code

Create a soccer league dashboard app with Akka and deploy to IBM Cloud

akka

akka

case-study

Now You See Me, Now You Don’t: LinkedIn’s Real-Time Presence Platform

akkaplay

akkaplay

webinar

Streaming Microservices with Akka Streams and Kafka Streams

microservicesfast-data

microservicesfast-data

community

Akka on Gitter

akka

akka

community

Play Framework on Gitter

play

play

community

Lagom on Gitter

lagom

lagom

code

Lagom Recipes

lagom

lagom

documentation

Lightbend Telemetry

enterprise-suite

enterprise-suite

webinar

Microservices and Fast Data: Industry and Architecture Trends

fast-dataenterprise-suite

fast-dataenterprise-suite

webinar

Operationalizing Machine Learning - Serving ML Models

fast-data

fast-data

code

Get started with Reactive Integration

tech-hub-guide

Deploying clustered Akka applications on Kubernetes

akka

akka

video

One Digital: Verizon Wireless Reactive Commerce Transformation Journey

akkaplay

akkaplay

code

Introduction to JDBC Streaming for Java Developers

tech-hub-blog

Introduction to Reactive Streams for Java Developers

project-starter

Hello Lagom (Scala/sbt)

lagom

lagom

project-starter

Hello Lagom (Java/Maven)

lagom

lagom

learning-path

Akka

akka

akka

manifesto

Reactive Manifesto

learning-path

Lagom Framework

lagom

lagom

report

The Need For Speed: Fast Data Development Trends

fast-data

fast-data

video

Lightbend Fast Data Platform Demonstration

legacy-modernizationfast-dataenterprise-suite

legacy-modernizationfast-dataenterprise-suite

video

Designing Fast Data Applications - Resilient, Scalable Architectures And Deployment Strategies

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Building Fast Data Applications - Developer Tools For Performance Tuning And Deployment

legacy-modernizationfast-data

legacy-modernizationfast-data

video

Running Fast Data Applications - Intelligent Monitoring And Troubleshooting

legacy-modernizationfast-dataenterprise-suite

legacy-modernizationfast-dataenterprise-suite

podcast

Running Fast Data Applications - Resilient Production Tools And One-Stop Support

fast-data

fast-data

podcast

Building Fast Data Applications - Developer Tools For Performance Tuning And Deployment

fast-data

fast-data

podcast

Running Fast Data Applications - Intelligent Monitoring And Troubleshooting

fast-data

fast-data

podcast

Designing Fast Data Applications - Resilient, Scalable Architectures And Deployment Strategies

fast-data

fast-data

podcast

Building Fast Data Applications - Development Team Enablement And Productivity

fast-data

fast-data

podcast

Designing Fast Data Applications - How To Choose The Right Streaming Engine

fast-data

fast-data

podcast

Understanding Fast Data Applications - The Why, What, And How

fast-data

fast-data

podcast

Introducing A New Remote/Onsite Training Course To Learn About Reactive Architectures

podcast

Going Reactive: How To Design And Implement An Entire Distributed System (with Jan Machacek)

podcast

Integrating Akka Streams with Akka Actors In Cloud-Based Reactive Systems (with Colin Breck)

akka

akka

podcast

What Makes Play Framework So Fast? (with Will Sargent)

play

play

podcast

Goodbye Activator/Hello Tech Hub, Plus Meet Lightbend’s New Tooling Team (with Eugene Yokota)

akkaplaylagomscala

akkaplaylagomscala

podcast

Play 2.6 Is Coming, And It's Faster Than Ever (with Will Sargent)

play

play

podcast

What's New In Akka 2.5 With Akka Tech Lead Patrik Nordwall

video

Running Fast Data Applications - Resilient Production Tools And One-Stop Support

fast-data

fast-data

video

Building Fast Data Applications - Development Team Enablement And Productivity

fast-data

fast-data

video

Designing Fast Data Applications - How To Choose The Right Streaming Engine

fast-data

fast-data

video

Understanding Fast Data Applications - The Why, What, And How

fast-data

fast-data

webinar

Advanced Akka For Architects

enterprise-suiteakka

enterprise-suiteakka

webinar

A Tale of Two APIs: Using Spark Streaming In Production

fast-data

fast-data

webinar

Developing Secure Scala Applications With Fortify For Scala

scala

scala

ebook

Serving Machine Learning Models

fast-data

fast-data

case-study

America’s Largest Telecommunications Provider Goes Reactive

legacy-modernizationakkaplayjava

legacy-modernizationakkaplayjava

webinar

Intelligently Monitor and Rapidly Troubleshoot Streaming Fast Data Applications

legacy-modernizationmicroservicesfast-dataakka

legacy-modernizationmicroservicesfast-dataakka

white-paper

The Financial Service Industry’s New Competitive Platform

legacy-modernization

legacy-modernization

webinar

Design Streaming Fast Data Applications With Spark, Akka, Kafka and Cassandra on Mesos

fast-dataakka

fast-dataakka

report

Lightbend is Reactive to customer demand with general availability of Fast Data Platform

fast-data

fast-data

ebook

Learning Spark Streaming

fast-data

fast-data

ebook

Reactive Systems Architecture

microservices

microservices

video

How Can Lightbend Fast Data Platform Help? - Episode 3

fast-data

fast-data

video

What's Hard About Fast Data? - Episode 2

fast-data

fast-data

video

Fast Data: How Did We Get Here? - Episode 1

fast-data

fast-data

webinar

Akka Revealed: A JVM Architect’s Journey From Resilient Actors To Scalable Clusters

akka

akka

ebook

Domain-Driven Design Distilled

legacy-modernizationmicroservices

legacy-modernizationmicroservices

video

Introducing "Lightbend Reactive Architecture - Professional” Remote/Onsite Training Course

legacy-modernizationmicroservices

legacy-modernizationmicroservices

webinar

Why IBM + Lightbend

scalajava

scalajava

ebook

Reactive Microservices: From Prototype To Production Ready Systems

microservices

microservices

ebook

Reactive Microsystems: The Evolution of Microservices at Scale

microservices

microservices

white-paper

Play Framework: The JVM Architect’s Path to Super-Fast Web Apps

legacy-modernizationplay

legacy-modernizationplay

video

I Love Scala for Machine Learning

fast-datascala

fast-datascala

webinar

What's The Role of Machine Learning In Fast Data and Streaming Applications?

fast-data

fast-data

webinar

Moving from Big Data to Fast Data? Here's How To Pick The Right Streaming Engine

fast-data

fast-data

case-study

Vivint Grows Market Share in IoT Smart Home Industry With Fast Data System Based on Lightbend Platform

internet-of-thingsfast-dataakka

internet-of-thingsfast-dataakka

white-paper

How To Resolve Network Partitions In Seconds With Lightbend Enterprise Suite

enterprise-suite

enterprise-suite

white-paper

Modernization:
The End Of Heavyweight Era

legacy-modernizationakka

legacy-modernizationakka

webinar

Five Early Challenges Of Building Streaming & Fast Data Applications

fast-dataakka

fast-dataakka

technical-overview

Lightbend Fast Data Platform - A Technical Overview For Decision Makers

fast-dataakkaplaylagom

fast-dataakkaplaylagom

white-paper

The Secrets To Successfully Monitoring Fast Data And Streaming Applications

fast-dataenterprise-suite

fast-dataenterprise-suite

webinar

How Credit Karma Makes Real-Time Decisions for 60 Million Users with Akka Streams and Apache Kafka

fast-dataakka

fast-dataakka

case-study

Flipkart Reduces Infrastructure By 75% And "Connekts" With 70 Million Shoppers Using Reactive Microservices

legacy-modernizationcustomer-engagementmicroservices

legacy-modernizationcustomer-engagementmicroservices

case-study

Weight Watchers Accelerates Digital Transformation With Lightbend

microservicesfast-dataakkaplayscala

microservicesfast-dataakkaplayscala

case-study

Using Akka, Spark and Cassandra To Scale Real Time Auto Loan Decisioning At Capital One

microservicesfast-dataakka

microservicesfast-dataakka

video

Replacing Cron & Building Scalable Data Pipelines At Airbnb

legacy-modernizationscala

legacy-modernizationscala

white-paper

Microservices in Production: What Ops Should Know About Reactive Systems

microservicesenterprise-suite

microservicesenterprise-suite

report

Enterprise Development Trends 2016

microservices

microservices

ebook

Learn Scala for Java Developers

scalajava

scalajava

webinar

Building Streaming and Fast Data Applications with Spark, Mesos, Akka, Cassandra and Kafka

fast-dataakka

fast-dataakka

webinar

Developing Fast Data Architectures with Streaming Applications

fast-dataakka

fast-dataakka

webinar

Using the Actor Model with Domain-Driven Design (DDD) in Reactive Systems

microservicesakka

microservicesakka

podcast

Interview: CEO Mark Brewer On Lightbend's Acquisition Of OpsClarity

podcast

Reflections With Adriaan Moors On 10 Years With Scala

scala

scala

webinar

Exploring Reactive Integrations with Akka Streams, Alpakka and Kafka

microservicesfast-dataakkalagomscalajava

microservicesfast-dataakkalagomscalajava

case-study

Credit Karma Disrupts Credit Reporting With Reactive Systems And Fast Data

legacy-modernizationcustomer-engagementfast-data

legacy-modernizationcustomer-engagementfast-data

podcast

Reactive Programming vs Reactive Systems, Explained

white-paper

Getting Started with Spark

fast-data

fast-data

white-paper

Reactive Programming vs Reactive Systems

microservices

microservices

webinar

The Basics Of Reactive System Design For Traditional Java Enterprises

microservicesakkalagomjavalegacy-modernization

microservicesakkalagomjavalegacy-modernization

webinar

Distributed Systems Done Right: Why Java Enterprises Are Embracing The Actor Model

microservicesakkascalajava

microservicesakkascalajava

case-study

PayPal Blows Past 1 Billion Transactions Per Day Using Just 8 VMs With Akka, Scala, Kafka and Akka Streams

legacy-modernizationcustomer-engagementmicroservicesakkascala

legacy-modernizationcustomer-engagementmicroservicesakkascala

webinar

Lessons Learned From PayPal: Implementing Back-Pressure With Akka Streams And Kafka

microservicesfast-dataakkascalalegacy-modernization

microservicesfast-dataakkascalalegacy-modernization

webinar

Fast Data: Selecting The Right Streaming Technologies For Data Sets That Never End

microservicesfast-dataakkascalajava

microservicesfast-dataakkascalajava

webinar

Introducing Reactive Platform 2.0

microservicesakkaplaylagomscalajava

microservicesakkaplaylagomscalajava

case-study

Swisscom Revolutionizes Urban Planning Data With Real-Time Mobile Analytics

new-businessmicroservicesfast-dataakkascala

new-businessmicroservicesfast-dataakkascala

technical-overview

Lightbend Reactive Platform

akkaplaylagomscalajava

akkaplaylagomscalajava

report

Going Reactive 2016: How Microservices and Fast Data are driving mainstream adoption of Reactive systems

microservicesfast-data

microservicesfast-data

webinar

Overcoming Tough Architecture Challenges In Your Next Modernization Project

legacy-modernizationmicroservicesfast-dataenterprise-suite

legacy-modernizationmicroservicesfast-dataenterprise-suite

case-study

Zalando Reaches Past $3 Billion In Sales Amid 100x Traffic Spikes Using Reactive Platform

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

ebook

Designing Reactive Systems: The Role Of Actors In Distributed Architecture

akka

akka

ebook

Fast Data Architectures For Streaming Applications

fast-data

fast-data

webinar

Monitoring Microservices in Production with Lightbend Platform

microservicesfast-dataenterprise-suiteakkaplaylagomscalajava

microservicesfast-dataenterprise-suiteakkaplaylagomscalajava

case-study

Distributed Mesh In The Home: How Eero Is Disrupting Consumer WiFi With Highly Reliable Systems Powered By Akka And Reactive

internet-of-thingsakkascala

internet-of-thingsakkascala

webinar

Modernizing Applications with Microservices and DCOS

microservicesscala

microservicesscala

webinar

Lessons Learned From Verizon: Implementing Microservices

microservicesscalaplaynew-business

microservicesscalaplaynew-business

webinar

The Future of Services: Building Asynchronous, Resilient and Elastic Systems

microservices

microservices

webinar

Understanding Akka Streams, Back Pressure and Asynchronous Architectures

microservicesfast-datascalaakkajavainternet-of-things

microservicesfast-datascalaakkajavainternet-of-things

webinar

The Enterprise Architect’s Intro to Microservices - Part 3: Bending Reality with Microservices in Production Systems

microserviceslegacy-modernization

microserviceslegacy-modernization

webinar

The Enterprise Architect’s Intro to Microservices - Part 2: The 6 Traits of Reactive Microservices

microserviceslegacy-modernization

microserviceslegacy-modernization

podcast

AMA with Our Experts Podcast Ep. 09 with Andreas Evers

microserviceslagom

microserviceslagom

webinar

The Enterprise Architect’s Intro to Microservices - Part 1: Microservices, Monoliths, SOA and How We Got Here

microserviceslegacy-modernization

microserviceslegacy-modernization

ebook

Developing Reactive Microservices

microservices

microservices

ebook

Reactive Machine Learning Systems

podcast

AMA with Our Experts Podcast Ep. 08 with Jamie Allen

podcast

AMA with Our Experts Podcast Ep. 07 with Markus Eisele

microserviceslagomjava

microserviceslagomjava

case-study

Norwegian Cruises To Record Profits With Reactive

legacy-modernizationinternet-of-thingscustomer-engagementakkaplayscala

legacy-modernizationinternet-of-thingscustomer-engagementakkaplayscala

ebook

Reactive Microservices Architecture

microservices

microservices

podcast

AMA with Our Experts Podcast Ep. 06 with Justin Pihony

podcast

AMA with Our Experts Podcast Ep. 05 with Viktor Klang

microservices

microservices

podcast

AMA with Our Experts Podcast Ep. 04 with Oliver White

podcast

AMA with Our Experts Podcast Ep. 03 with Jonas Bonér

microservices

microservices

podcast

Lightbend Reactive Platform: new commercial features - Jamie Allen

akka

akka

podcast

Akka 2.4 plus new commercial features in Lightbend Reactive Platform - Konrad Malawski

akka

akka

podcast

AMA with Our Experts Podcast Ep. 02 with Konrad Malawski

podcast

AMA with Our Experts Podcast Ep. 01 with Dean Wampler

fast-data

fast-data

podcast

Welcome To Reactive Monitoring Beta Program - Henrik Engström and Tal Weiss

enterprise-suite

enterprise-suite

case-study

Intel's GearPump Real-Time Streaming Engine Using Akka

new-businessmicroservicesfast-dataakkascala

new-businessmicroservicesfast-dataakkascala

case-study

Reactive Drives Innovation In Streaming Music Industry

legacy-modernizationcustomer-engagementmicroservicesakka

legacy-modernizationcustomer-engagementmicroservicesakka

case-study

Samsung Strategy And Innovation Center Executes IoT Vision At Startup-Speed With Reactive Architecture

internet-of-thingsnew-businessmicroservicesfast-dataakkaplayscala

internet-of-thingsnew-businessmicroservicesfast-dataakkaplayscala

podcast

How To Deploy Spark To Mesos, EC2 Or Standalone With Lightbend - Iulian Dragos

fast-data

fast-data

case-study

How Apache Spark, Scala, And Functional Programming Made Hard Problems Easy At Barclays

fast-datascala

fast-datascala

podcast

Reactive Revealed 3 3 Resiliency, Failures Vs Errors, Isolation, Delegation - Jonas Bonér

webinar

Akka 2.4 Plus New Commercial Features in Lightbend Reactive Platform

microservicesakkascalajava

microservicesakkascalajava

white-paper

An Introduction to Reactive Streams, Akka Streams and Akka HTTP for Enterprise Architects

akka

akka

podcast

Elasticity, Scalability And Location Transparency In Reactive Systems - Viktor Klang

webinar

Reactive Revealed 2/3: Elasticity, Scalability and Location Transparency in Reactive systems

microservices

microservices

case-study

How Dwango Scaled Live Streaming With Play And Akka

legacy-modernizationakkaplayscala

legacy-modernizationakkaplayscala

white-paper

Fast Data: Big Data Evolved

fast-data

fast-data

case-study

UniCredit Powers “Fast Data” Customer-Insight Platform With Apache Spark, Scala, Akka And Play

legacy-modernizationcustomer-engagementmicroservicesfast-dataakkaplayscala

legacy-modernizationcustomer-engagementmicroservicesfast-dataakkaplayscala

case-study

UK’s Online Gaming Leader Bets Big On Reactive To Drive Real-Time Personalization

customer-engagementmicroservicesfast-dataakkaplayscala

customer-engagementmicroservicesfast-dataakkaplayscala

podcast

Asynchronous I O, Back - Pressure And The Message - Driven Vs. Event - Driven - Konrad Malawski

webinar

Reactive Revealed 1/3: Async NIO, Back-pressure and Message-driven vs Event-driven

akka

akka

webinar

​Microservices 101: Exploiting Reality's Constraints with Technology

microservicesscalajava

microservicesscalajava

podcast

Four Things To Know About Reliable Spark Streaming - Tathagata Das and Dean Wampler

fast-data

fast-data

webinar

Four things to know about reliable Spark Streaming

fast-datascala

fast-datascala

webinar

Akka Streams 1.0 and Slick 3.0

akka

akka

webinar

Modernizing Your Aging Architecture: What Every Enterprise Architect Needs To Know About Going Reactive

microservicesfast-datalegacy-modernization

microservicesfast-datalegacy-modernization

podcast

Using Spark, Kafka, Cassandra And Akka On Mesos For Real Time Personalization - Patrick Di Loreto

fast-data

fast-data

case-study

Dutch E-Commerce Giant Wehkamp Drives Global Expansion By Modernizing Systems For “Reactive”

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

legacy-modernizationmarket-expansionmicroservicesfast-dataakkaplayscala

webinar

Using Spark, Kafka, Cassandra and Akka on Mesos for Real-Time Personalization

microservicesfast-dataakkaplayscalacustomer-engagement

microservicesfast-dataakkaplayscalacustomer-engagement

webinar

Reactive Streams 1.0.0 and Why You Should Care

akkascala

akkascala

ebook

Functional and Reactive Domain Modeling

case-study

UK Price Comparison Leader Goes "Reactive" To Fuel Next Phase Of Growth

legacy-modernizationmarket-expansionmicroservicesakkaplay

legacy-modernizationmarket-expansionmicroservicesakkaplay

case-study

New Tweets Per Second Record, And How!

legacy-modernizationcustomer-engagementscala

legacy-modernizationcustomer-engagementscala

ebook

Spark in Action

fast-data

fast-data

case-study

47 Degrees adopts the Lightbend Platform

legacy-modernizationnew-businessmicroservicesakkaplayscala

legacy-modernizationnew-businessmicroservicesakkaplayscala

case-study

A British Consultancy Chooses Lightbend

legacy-modernizationnew-businessmicroservicesfast-dataakkaplayscala

legacy-modernizationnew-businessmicroservicesfast-dataakkaplayscala

case-study

Keeping Borders Safe With Akka

legacy-modernizationinternet-of-thingsakkascala

legacy-modernizationinternet-of-thingsakkascala

case-study

Lightbend Aids In Train Safety In The Netherlands

scalaakka

scalaakka

podcast

Going Reactive In Java With Lightbend Reactive Platform - Jamie Allen

case-study

From 5 To 50 Million Users And Beyond: Why Wix Went Reactive

legacy-modernizationscala

legacy-modernizationscala

case-study

2.2 Billion Clicks And Beyond: How Hootsuite Modernized Its URL Shortener To Scala/Akka Using The Lightbend Reactive Platform

legacy-modernizationmicroservicesakkascala

legacy-modernizationmicroservicesakkascala

case-study

Walmart Boosts Conversions By 20% With Lightbend Reactive Platform

legacy-modernizationcustomer-engagementmicroservicesakkaplayscala

legacy-modernizationcustomer-engagementmicroservicesakkaplayscala

webinar

Akka for Java Devs: Bridging the Imagination Divide

akkascalajava

akkascalajava

ebook

Reactive Web Applications

webinar

Trends and Adoption: What's Hot in Apache Spark

fast-datascalaakka

fast-datascalaakka

ebook

Reactive Application Development

report

Apache Spark: Preparing for the Next Wave of Reactive Big Data

fast-data

fast-data

report

Java 8 Report II: A Global Survey of 3,030 Java Professionals

java

java

ebook

Play Framework Essentials

play

play

ebook

SBT in Action

scala

scala

ebook

Akka in Action

akka

akka

ebook

Atomic Scala

scala

scala

ebook

Functional Programming in Scala

scala

scala

ebook

Java 8 in Action

java

java

ebook

Play for Java

playjava

playjava

ebook

Play for Scala

playscala

playscala

ebook

Reactive Design Patterns

ebook

Scala for the Impatient

scala

scala

ebook

Scala in Depth

scala

scala

ebook

Spark GraphX in Action

fast-data

fast-data

report

Java 8 Report I

java

java

white-paper

Why the Media Industry is Going Reactive